Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 8603..9195 Replicon plasmid P4
Accession NZ_OW967007
Organism Escherichia coli isolate 624

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I9ZJC5
Locus tag LQ179_RS26640 Protein ID WP_000513532.1
Coordinates 8603..8851 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A1I9ZJ49
Locus tag LQ179_RS26645 Protein ID WP_000681609.1
Coordinates 8848..9195 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ179_RS26600 (AI2834V1_5161) 3687..4352 - 666 WP_064770720.1 division plane positioning ATPase MipZ -
LQ179_RS26605 (AI2834V1_5162) 4950..5279 + 330 WP_000855121.1 hypothetical protein -
LQ179_RS26610 (AI2834V1_5163) 5860..6183 + 324 WP_000427402.1 hypothetical protein -
LQ179_RS26615 (AI2834V1_5164) 6226..6435 + 210 WP_000866037.1 hypothetical protein -
LQ179_RS26620 (AI2834V1_5165) 6533..6757 + 225 WP_032716097.1 hypothetical protein -
LQ179_RS26625 (AI2834V1_5166) 6809..7069 + 261 WP_062897940.1 hypothetical protein -
LQ179_RS26630 (AI2834V1_5167) 7059..7310 + 252 WP_000931278.1 transcriptional regulator -
LQ179_RS26635 (AI2834V1_5169) 7860..8138 + 279 WP_000545937.1 hypothetical protein -
LQ179_RS26640 (AI2834V1_5171) 8603..8851 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin Toxin
LQ179_RS26645 (AI2834V1_5172) 8848..9195 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LQ179_RS26650 (AI2834V1_5173) 9259..9726 - 468 WP_230138872.1 hypothetical protein -
LQ179_RS26655 (AI2834V1_5174) 9967..10266 + 300 WP_000466320.1 type II toxin-antitoxin system HicB family antitoxin -
LQ179_RS26660 (AI2834V1_5175) 10526..10852 - 327 WP_032345720.1 hypothetical protein -
LQ179_RS26665 (AI2834V1_5176) 10872..11579 - 708 WP_000108794.1 hypothetical protein -
LQ179_RS26670 (AI2834V1_5177) 11581..12333 - 753 WP_000797966.1 conjugal transfer protein TraL -
LQ179_RS26675 (AI2834V1_5178) 12351..12752 - 402 WP_021575837.1 hypothetical protein -
LQ179_RS26680 (AI2834V1_5179) 13120..13461 + 342 WP_000730722.1 plasmid mobilization relaxosome protein MobC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..63154 63154


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9378.03 Da        Isoelectric Point: 10.4800

>T295753 WP_000513532.1 NZ_OW967007:8603-8851 [Escherichia coli]
MGKADKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
VL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13206.97 Da        Isoelectric Point: 4.8313

>AT295753 WP_000681609.1 NZ_OW967007:8848-9195 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNILYGKLAFIRDLVTYEAETLADLEREFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSHHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I9ZJC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1I9ZJ49

References