295752

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 6809..7310 Replicon plasmid P4
Accession NZ_OW967007
Organism Escherichia coli isolate 624

Toxin (Protein)


Gene name TsxA Uniprot ID -
Locus tag LQ179_RS26625 Protein ID WP_062897940.1
Coordinates 6809..7069 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag LQ179_RS26630 Protein ID WP_000931278.1
Coordinates 7059..7310 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ179_RS26575 (AI2834V1_5157) 2045..2206 + 162 WP_001128311.1 hypothetical protein -
LQ179_RS26580 2341..2493 + 153 WP_001414491.1 DUF5431 family protein -
LQ179_RS26585 2438..2560 + 123 WP_223685802.1 Hok/Gef family protein -
LQ179_RS26590 (AI2834V1_5159) 2710..3306 + 597 WP_000125165.1 ProQ/FINO family protein -
LQ179_RS26595 (AI2834V1_5160) 3324..3608 - 285 WP_001542021.1 hypothetical protein -
LQ179_RS26600 (AI2834V1_5161) 3687..4352 - 666 WP_064770720.1 division plane positioning ATPase MipZ -
LQ179_RS26605 (AI2834V1_5162) 4950..5279 + 330 WP_000855121.1 hypothetical protein -
LQ179_RS26610 (AI2834V1_5163) 5860..6183 + 324 WP_000427402.1 hypothetical protein -
LQ179_RS26615 (AI2834V1_5164) 6226..6435 + 210 WP_000866037.1 hypothetical protein -
LQ179_RS26620 (AI2834V1_5165) 6533..6757 + 225 WP_032716097.1 hypothetical protein -
LQ179_RS26625 (AI2834V1_5166) 6809..7069 + 261 WP_062897940.1 hypothetical protein Toxin
LQ179_RS26630 (AI2834V1_5167) 7059..7310 + 252 WP_000931278.1 transcriptional regulator Antitoxin
LQ179_RS26635 (AI2834V1_5169) 7860..8138 + 279 WP_000545937.1 hypothetical protein -
LQ179_RS26640 (AI2834V1_5171) 8603..8851 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
LQ179_RS26645 (AI2834V1_5172) 8848..9195 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
LQ179_RS26650 (AI2834V1_5173) 9259..9726 - 468 WP_230138872.1 hypothetical protein -
LQ179_RS26655 (AI2834V1_5174) 9967..10266 + 300 WP_000466320.1 type II toxin-antitoxin system HicB family antitoxin -
LQ179_RS26660 (AI2834V1_5175) 10526..10852 - 327 WP_032345720.1 hypothetical protein -
LQ179_RS26665 (AI2834V1_5176) 10872..11579 - 708 WP_000108794.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..63154 63154


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9877.39 Da        Isoelectric Point: 10.0665

>T295752 WP_062897940.1 NZ_OW967007:6809-7069 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVFMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9420.81 Da        Isoelectric Point: 9.8120

>AT295752 WP_000931278.1 NZ_OW967007:7059-7310 [Escherichia coli]
MLNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References