Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 68822..69369 Replicon plasmid P1
Accession NZ_OW967004
Organism Escherichia coli isolate 624

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag LQ179_RS25300 Protein ID WP_001384452.1
Coordinates 68822..69100 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag LQ179_RS25305 Protein ID WP_000079941.1
Coordinates 69100..69369 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ179_RS25275 (64493) 64493..65209 + 717 Protein_51 Tn3 family transposase -
LQ179_RS25280 (65242) 65242..65376 - 135 Protein_52 DUF6404 family protein -
LQ179_RS25285 (65505) 65505..65840 + 336 WP_001080729.1 colicin 1A immunity protein -
LQ179_RS25290 (65862) 65862..67742 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
LQ179_RS25295 (67928) 67928..68776 - 849 WP_001057989.1 3'-5' exonuclease -
LQ179_RS25300 (68822) 68822..69100 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
LQ179_RS25305 (69100) 69100..69369 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
LQ179_RS25310 (70285) 70285..71142 - 858 WP_001514234.1 incFII family plasmid replication initiator RepA -
LQ179_RS25315 (71135) 71135..71209 - 75 WP_001365705.1 RepA leader peptide Tap -
LQ179_RS25320 (71434) 71434..71694 - 261 WP_000083819.1 replication regulatory protein RepA -
LQ179_RS25325 (71934) 71934..72524 - 591 WP_000766816.1 DUF2726 domain-containing protein -
LQ179_RS25330 (72563) 72563..72772 - 210 WP_001514235.1 hemolysin expression modulator Hha -
LQ179_RS25335 (72818) 72818..73279 - 462 WP_001514236.1 thermonuclease family protein -
LQ179_RS25340 (73524) 73524..73736 - 213 WP_001371875.1 ANR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1C / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..145385 145385


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T295751 WP_001384452.1 NZ_OW967004:c69100-68822 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT295751 WP_000079941.1 NZ_OW967004:c69369-69100 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References