Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4283126..4283780 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | LQ179_RS20610 | Protein ID | WP_000244781.1 |
Coordinates | 4283373..4283780 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | LQ179_RS20605 | Protein ID | WP_000354046.1 |
Coordinates | 4283126..4283392 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS20585 (4279214) | 4279214..4280647 | - | 1434 | WP_001394742.1 | 6-phospho-beta-glucosidase BglA | - |
LQ179_RS20590 (4280692) | 4280692..4281003 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ179_RS20595 (4281167) | 4281167..4281826 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
LQ179_RS20600 (4281903) | 4281903..4282883 | - | 981 | WP_000886087.1 | tRNA-modifying protein YgfZ | - |
LQ179_RS20605 (4283126) | 4283126..4283392 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
LQ179_RS20610 (4283373) | 4283373..4283780 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
LQ179_RS20615 (4283820) | 4283820..4284341 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
LQ179_RS20620 (4284453) | 4284453..4285349 | + | 897 | WP_000806650.1 | site-specific tyrosine recombinase XerD | - |
LQ179_RS20625 (4285374) | 4285374..4286084 | + | 711 | WP_000715222.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ179_RS20630 (4286090) | 4286090..4287823 | + | 1734 | WP_000813233.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T295749 WP_000244781.1 NZ_OW967003:4283373-4283780 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|