Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4172213..4173032 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | LQ179_RS20040 | Protein ID | WP_230138841.1 |
Coordinates | 4172213..4172590 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | LQ179_RS20045 | Protein ID | WP_230138842.1 |
Coordinates | 4172679..4173032 (-) | Length | 118 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS20020 (4170011) | 4170011..4171231 | + | 1221 | WP_000794251.1 | capsular biosynthesis protein | - |
LQ179_RS20025 (4171257) | 4171257..4171487 | - | 231 | Protein_3920 | hypothetical protein | - |
LQ179_RS20030 (4171593) | 4171593..4171769 | - | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
LQ179_RS20035 (4171786) | 4171786..4172216 | - | 431 | Protein_3922 | DUF5983 family protein | - |
LQ179_RS20040 (4172213) | 4172213..4172590 | - | 378 | WP_230138841.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
LQ179_RS20045 (4172679) | 4172679..4173032 | - | 354 | WP_230138842.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
LQ179_RS20050 (4173106) | 4173106..4173327 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
LQ179_RS20055 (4173390) | 4173390..4173866 | - | 477 | WP_001186773.1 | RadC family protein | - |
LQ179_RS20060 (4173882) | 4173882..4174367 | - | 486 | WP_230138843.1 | antirestriction protein | - |
LQ179_RS20065 (4174459) | 4174459..4175280 | - | 822 | WP_230138844.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | ugd / kpsS | 4148235..4193676 | 45441 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14101.15 Da Isoelectric Point: 7.2436
>T295748 WP_230138841.1 NZ_OW967003:c4172590-4172213 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|