Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4010710..4011545 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
Locus tag | LQ179_RS19290 | Protein ID | WP_000854722.1 |
Coordinates | 4011168..4011545 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0K4A940 |
Locus tag | LQ179_RS19285 | Protein ID | WP_001285576.1 |
Coordinates | 4010710..4011078 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS19260 (4008112) | 4008112..4008345 | + | 234 | WP_001117566.1 | DUF905 family protein | - |
LQ179_RS19265 (4008435) | 4008435..4009253 | + | 819 | WP_001234397.1 | DUF932 domain-containing protein | - |
LQ179_RS19270 (4009345) | 4009345..4009830 | + | 486 | WP_139496173.1 | antirestriction protein | - |
LQ179_RS19275 (4009846) | 4009846..4010322 | + | 477 | WP_001360063.1 | RadC family protein | - |
LQ179_RS19280 (4010409) | 4010409..4010630 | + | 222 | WP_000692176.1 | DUF987 domain-containing protein | - |
LQ179_RS19285 (4010710) | 4010710..4011078 | + | 369 | WP_001285576.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ179_RS19290 (4011168) | 4011168..4011545 | + | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
LQ179_RS19295 (4011542) | 4011542..4012030 | + | 489 | WP_000761669.1 | DUF5983 family protein | - |
LQ179_RS19300 (4012050) | 4012050..4012247 | + | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
LQ179_RS19305 (4012332) | 4012332..4013177 | + | 846 | WP_001280427.1 | DUF4942 domain-containing protein | - |
LQ179_RS19315 (4013477) | 4013477..4013983 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
LQ179_RS19320 (4014062) | 4014062..4015903 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T295747 WP_000854722.1 NZ_OW967003:4011168-4011545 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13599.36 Da Isoelectric Point: 6.3159
>AT295747 WP_001285576.1 NZ_OW967003:4010710-4011078 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J5ZPW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K4A940 |