Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 2571019..2571614 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | LQ179_RS12315 | Protein ID | WP_000239581.1 |
Coordinates | 2571019..2571369 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | LQ179_RS12320 | Protein ID | WP_001223213.1 |
Coordinates | 2571363..2571614 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS12295 (2566473) | 2566473..2567495 | - | 1023 | WP_001298067.1 | ABC transporter permease | - |
LQ179_RS12300 (2567509) | 2567509..2569011 | - | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
LQ179_RS12305 (2569144) | 2569144..2570100 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
LQ179_RS12310 (2570410) | 2570410..2570940 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
LQ179_RS12315 (2571019) | 2571019..2571369 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
LQ179_RS12320 (2571363) | 2571363..2571614 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
LQ179_RS12325 (2571826) | 2571826..2572167 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
LQ179_RS12330 (2572170) | 2572170..2575949 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T295743 WP_000239581.1 NZ_OW967003:c2571369-2571019 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|