Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2506332..2507167 Replicon chromosome
Accession NZ_OW967003
Organism Escherichia coli isolate 624

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2S4A272
Locus tag LQ179_RS11990 Protein ID WP_001094443.1
Coordinates 2506332..2506709 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7LDN9
Locus tag LQ179_RS11995 Protein ID WP_001285607.1
Coordinates 2506799..2507167 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ179_RS11960 (2502743) 2502743..2503636 + 894 WP_032172247.1 WYL domain-containing protein -
LQ179_RS11965 (2503834) 2503834..2504034 - 201 Protein_2350 transposase -
LQ179_RS11970 (2504154) 2504154..2504935 - 782 Protein_2351 integrase arm-type DNA-binding domain-containing protein -
LQ179_RS11975 (2505402) 2505402..2505545 - 144 Protein_2352 hypothetical protein -
LQ179_RS11980 (2505630) 2505630..2505827 - 198 WP_001327226.1 DUF957 domain-containing protein -
LQ179_RS11985 (2505847) 2505847..2506335 - 489 WP_000761685.1 DUF5983 family protein -
LQ179_RS11990 (2506332) 2506332..2506709 - 378 WP_001094443.1 TA system toxin CbtA family protein Toxin
LQ179_RS11995 (2506799) 2506799..2507167 - 369 WP_001285607.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ179_RS12000 (2507247) 2507247..2507468 - 222 WP_000692350.1 DUF987 domain-containing protein -
LQ179_RS12005 (2507555) 2507555..2508031 - 477 WP_001186165.1 RadC family protein -
LQ179_RS12010 (2508046) 2508046..2508531 - 486 WP_000206664.1 antirestriction protein -
LQ179_RS12015 (2508623) 2508623..2509441 - 819 WP_001175163.1 DUF932 domain-containing protein -
LQ179_RS12020 (2509531) 2509531..2509764 - 234 WP_001278287.1 DUF905 family protein -
LQ179_RS12025 (2509770) 2509770..2510447 - 678 WP_001097301.1 hypothetical protein -
LQ179_RS12030 (2510595) 2510595..2511275 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2503930..2504034 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14058.97 Da        Isoelectric Point: 7.3523

>T295742 WP_001094443.1 NZ_OW967003:c2506709-2506332 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13689.53 Da        Isoelectric Point: 6.4669

>AT295742 WP_001285607.1 NZ_OW967003:c2507167-2506799 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4A272

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0JLU8

References