Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2295555..2296105 Replicon chromosome
Accession NZ_OW967003
Organism Escherichia coli isolate 624

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag LQ179_RS11100 Protein ID WP_001160966.1
Coordinates 2295555..2295869 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag LQ179_RS11105 Protein ID WP_000125568.1
Coordinates 2295872..2296105 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ179_RS11075 (2291230) 2291230..2292516 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
LQ179_RS11080 (2292516) 2292516..2293505 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
LQ179_RS11085 (2293502) 2293502..2294323 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
LQ179_RS11090 (2294326) 2294326..2294703 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
LQ179_RS11095 (2294710) 2294710..2295558 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
LQ179_RS11100 (2295555) 2295555..2295869 - 315 WP_001160966.1 CcdB family protein Toxin
LQ179_RS11105 (2295872) 2295872..2296105 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LQ179_RS11110 (2296191) 2296191..2296670 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
LQ179_RS11115 (2296862) 2296862..2298724 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
LQ179_RS11120 (2298717) 2298717..2299247 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
LQ179_RS11125 (2299355) 2299355..2300686 - 1332 WP_001183201.1 MFS transporter -
LQ179_RS11130 (2300744) 2300744..2301031 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T295741 WP_001160966.1 NZ_OW967003:c2295869-2295555 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT295741 WP_000125568.1 NZ_OW967003:c2296105-2295872 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References