Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1873634..1874252 | Replicon | chromosome |
| Accession | NZ_OW967003 | ||
| Organism | Escherichia coli isolate 624 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | LQ179_RS09115 | Protein ID | WP_001291435.1 |
| Coordinates | 1874034..1874252 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | LQ179_RS09110 | Protein ID | WP_000344800.1 |
| Coordinates | 1873634..1874008 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ179_RS09100 (1868723) | 1868723..1869916 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ179_RS09105 (1869939) | 1869939..1873088 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| LQ179_RS09110 (1873634) | 1873634..1874008 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ179_RS09115 (1874034) | 1874034..1874252 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| LQ179_RS09120 (1874424) | 1874424..1874975 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
| LQ179_RS09125 (1875091) | 1875091..1875561 | + | 471 | WP_022645280.1 | YlaC family protein | - |
| LQ179_RS09130 (1875725) | 1875725..1877275 | + | 1551 | WP_022645279.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| LQ179_RS09135 (1877317) | 1877317..1877670 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| LQ179_RS09145 (1878049) | 1878049..1878360 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| LQ179_RS09150 (1878391) | 1878391..1878963 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295739 WP_001291435.1 NZ_OW967003:1874034-1874252 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT295739 WP_000344800.1 NZ_OW967003:1873634-1874008 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |