Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1457960..1458665 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | LQ179_RS07250 | Protein ID | WP_000539521.1 |
Coordinates | 1457960..1458346 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LQ179_RS07255 | Protein ID | WP_001280945.1 |
Coordinates | 1458336..1458665 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS07230 (1453964) | 1453964..1454590 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
LQ179_RS07235 (1454587) | 1454587..1455702 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
LQ179_RS07240 (1455813) | 1455813..1456196 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
LQ179_RS07245 (1456409) | 1456409..1457734 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
LQ179_RS07250 (1457960) | 1457960..1458346 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ179_RS07255 (1458336) | 1458336..1458665 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
LQ179_RS07260 (1458735) | 1458735..1460012 | - | 1278 | WP_230138809.1 | GGDEF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T295737 WP_000539521.1 NZ_OW967003:1457960-1458346 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|