Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 715323..715961 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | LQ179_RS03670 | Protein ID | WP_000813794.1 |
Coordinates | 715323..715499 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LQ179_RS03675 | Protein ID | WP_001270286.1 |
Coordinates | 715545..715961 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS03650 (710945) | 710945..712117 | - | 1173 | WP_230138799.1 | BenE family transporter YdcO | - |
LQ179_RS03655 (712209) | 712209..712745 | + | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
LQ179_RS03660 (712818) | 712818..714779 | + | 1962 | WP_077737811.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
LQ179_RS03665 (714871) | 714871..715101 | - | 231 | WP_000491567.1 | DUF2554 family protein | - |
LQ179_RS03670 (715323) | 715323..715499 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
LQ179_RS03675 (715545) | 715545..715961 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
LQ179_RS03680 (716040) | 716040..717446 | + | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
LQ179_RS03685 (717691) | 717691..718836 | + | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
LQ179_RS03690 (718854) | 718854..719867 | + | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
LQ179_RS03695 (719868) | 719868..720809 | + | 942 | WP_022645667.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T295735 WP_000813794.1 NZ_OW967003:715323-715499 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT295735 WP_001270286.1 NZ_OW967003:715545-715961 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|