Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 79545..80348 | Replicon | plasmid P2 |
Accession | NZ_OW849529 | ||
Organism | Citrobacter freundii isolate 22 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A7W3E3C9 |
Locus tag | LQ181_RS26845 | Protein ID | WP_022652313.1 |
Coordinates | 79818..80348 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | W8E6Q5 |
Locus tag | LQ181_RS26840 | Protein ID | WP_022652312.1 |
Coordinates | 79545..79814 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ181_RS26810 (AI2661V1_5223) | 74610..74840 | - | 231 | WP_023307222.1 | hypothetical protein | - |
LQ181_RS26815 (AI2661V1_5224) | 74854..75057 | - | 204 | WP_004213596.1 | HHA domain-containing protein | - |
LQ181_RS26820 (AI2661V1_5225) | 75302..76270 | + | 969 | WP_023307223.1 | IS5-like element IS903B family transposase | - |
LQ181_RS26825 | 76391..76459 | + | 69 | Protein_77 | serine/threonine protein kinase | - |
LQ181_RS26830 (AI2661V1_5226) | 76634..77374 | + | 741 | WP_022652310.1 | site-specific integrase | - |
LQ181_RS26835 (AI2661V1_5227) | 77700..78689 | - | 990 | WP_022652311.1 | RepB family plasmid replication initiator protein | - |
LQ181_RS26840 (AI2661V1_5228) | 79545..79814 | + | 270 | WP_022652312.1 | DUF1778 domain-containing protein | Antitoxin |
LQ181_RS26845 (AI2661V1_5229) | 79818..80348 | + | 531 | WP_022652313.1 | GNAT family N-acetyltransferase | Toxin |
LQ181_RS26850 (AI2661V1_5230) | 80516..81373 | + | 858 | WP_022652314.1 | IS5 family transposase | - |
LQ181_RS26855 (AI2661V1_REPA000000146) | 81514..82407 | - | 894 | Protein_83 | IS3 family transposase | - |
LQ181_RS26860 (AI2661V1_5232) | 82475..83626 | + | 1152 | WP_022652315.1 | IS30-like element IS30 family transposase | - |
LQ181_RS26865 (AI2661V1_5234) | 84115..84462 | + | 348 | WP_000609174.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) | - | 1..149443 | 149443 | |
- | inside | IScluster/Tn | - | - | 64491..87917 | 23426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20349.26 Da Isoelectric Point: 6.7496
>T295730 WP_022652313.1 NZ_OW849529:79818-80348 [Citrobacter freundii]
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3E3C9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2Z3XDS5 |