Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 168330..169231 Replicon plasmid P1
Accession NZ_OW849528
Organism Citrobacter freundii isolate 22

Toxin (Protein)


Gene name - Uniprot ID A0A837LJP8
Locus tag LQ181_RS26235 Protein ID WP_007372300.1
Coordinates 168330..168788 (-) Length 153 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag LQ181_RS26240 Protein ID WP_008786588.1
Coordinates 168785..169231 (-) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ181_RS26190 (AI2661V1_5094) 164011..164298 + 288 WP_016241556.1 hypothetical protein -
LQ181_RS26195 (AI2661V1_5095) 164309..164707 + 399 WP_007372292.1 hypothetical protein -
LQ181_RS26200 (AI2661V1_5096) 164791..165117 + 327 WP_007372293.1 hypothetical protein -
LQ181_RS26205 (AI2661V1_5098) 165480..165818 - 339 WP_007372294.1 hypothetical protein -
LQ181_RS26210 (AI2661V1_5099) 166056..166499 + 444 WP_007372295.1 hypothetical protein -
LQ181_RS26215 (AI2661V1_5100) 166618..166959 + 342 WP_007372296.1 hypothetical protein -
LQ181_RS26220 (AI2661V1_5101) 167118..167672 + 555 WP_047715717.1 hypothetical protein -
LQ181_RS26225 (AI2661V1_5102) 167722..167988 + 267 WP_007372298.1 hypothetical protein -
LQ181_RS26230 (AI2661V1_5103) 168056..168286 - 231 WP_007372299.1 hypothetical protein -
LQ181_RS26235 (AI2661V1_5104) 168330..168788 - 459 WP_007372300.1 RES family NAD+ phosphorylase Toxin
LQ181_RS26240 (AI2661V1_5105) 168785..169231 - 447 WP_008786588.1 DUF2384 domain-containing protein Antitoxin
LQ181_RS26245 (AI2661V1_5106) 169380..169697 + 318 WP_007372302.1 hypothetical protein -
LQ181_RS26250 (AI2661V1_5107) 169739..170581 + 843 WP_007372303.1 hypothetical protein -
LQ181_RS26255 (AI2661V1_5108) 170553..170831 + 279 WP_007372304.1 hypothetical protein -
LQ181_RS26260 (AI2661V1_5109) 170891..171334 + 444 WP_007372305.1 hypothetical protein -
LQ181_RS26265 (AI2661V1_5110) 171621..171785 + 165 WP_007372306.1 hypothetical protein -
LQ181_RS26270 (AI2661V1_5111) 172353..173195 + 843 WP_007372307.1 HNH endonuclease signature motif containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IIa / fosA3 / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-1 - 1..205393 205393


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre/MbcA/ParS-like, toxin-binding domain

(95-145)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 16975.40 Da        Isoelectric Point: 4.5730

>T295728 WP_007372300.1 NZ_OW849528:c168788-168330 [Citrobacter freundii]
VILYRLTKTRYLMTAWSGLGAKEAGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK

Download         Length: 459 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16689.02 Da        Isoelectric Point: 6.9812

>AT295728 WP_008786588.1 NZ_OW849528:c169231-168785 [Citrobacter freundii]
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837LJP8

Antitoxin

Source ID Structure

References