Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 161031..161581 Replicon plasmid P1
Accession NZ_OW849528
Organism Citrobacter freundii isolate 22

Toxin (Protein)


Gene name ccdB Uniprot ID S1EZ93
Locus tag LQ181_RS26165 Protein ID WP_007372286.1
Coordinates 161273..161581 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1FMC3
Locus tag LQ181_RS26160 Protein ID WP_007372285.1
Coordinates 161031..161270 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ181_RS26115 156039..156434 + 396 WP_024196081.1 hypothetical protein -
LQ181_RS26120 (AI2661V1_5079) 156616..156807 + 192 WP_016241560.1 hypothetical protein -
LQ181_RS26125 (AI2661V1_5080) 156938..157633 + 696 WP_007372278.1 hypothetical protein -
LQ181_RS26130 157656..157853 + 198 WP_032155220.1 Lar family restriction alleviation protein -
LQ181_RS26135 (AI2661V1_5081) 157906..158307 + 402 WP_230138374.1 hypothetical protein -
LQ181_RS26140 (AI2661V1_5082) 158511..158651 + 141 WP_007372281.1 hypothetical protein -
LQ181_RS26145 (AI2661V1_5083) 158667..159299 + 633 WP_007372282.1 hypothetical protein -
LQ181_RS26150 (AI2661V1_5085) 159757..160431 + 675 WP_008786597.1 hypothetical protein -
LQ181_RS26155 (AI2661V1_5086) 160428..160892 + 465 WP_008786596.1 hypothetical protein -
LQ181_RS26160 (AI2661V1_5087) 161031..161270 + 240 WP_007372285.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LQ181_RS26165 (AI2661V1_5088) 161273..161581 + 309 WP_007372286.1 CcdB family protein Toxin
LQ181_RS26170 (AI2661V1_5089) 161602..161760 + 159 WP_016241558.1 hypothetical protein -
LQ181_RS26175 (AI2661V1_5090) 161915..162469 + 555 WP_007372288.1 hypothetical protein -
LQ181_RS26180 (AI2661V1_5091) 162539..163156 + 618 WP_007372289.1 hypothetical protein -
LQ181_RS26185 (AI2661V1_5092) 163179..163709 + 531 WP_016241557.1 HAD domain-containing protein -
LQ181_RS26190 (AI2661V1_5094) 164011..164298 + 288 WP_016241556.1 hypothetical protein -
LQ181_RS26195 (AI2661V1_5095) 164309..164707 + 399 WP_007372292.1 hypothetical protein -
LQ181_RS26200 (AI2661V1_5096) 164791..165117 + 327 WP_007372293.1 hypothetical protein -
LQ181_RS26205 (AI2661V1_5098) 165480..165818 - 339 WP_007372294.1 hypothetical protein -
LQ181_RS26210 (AI2661V1_5099) 166056..166499 + 444 WP_007372295.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IIa / fosA3 / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrB4 / blaDHA-1 - 1..205393 205393


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11351.17 Da        Isoelectric Point: 8.5044

>T295727 WP_007372286.1 NZ_OW849528:161273-161581 [Citrobacter freundii]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8784.97 Da        Isoelectric Point: 8.6387

>AT295727 WP_007372285.1 NZ_OW849528:161031-161270 [Citrobacter freundii]
MQATAARQKKTVSVTLEPMLVQQAKDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ93

Antitoxin

Source ID Structure
AlphaFold DB S1FMC3

References