Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4934899..4935515 | Replicon | chromosome |
Accession | NZ_OW849527 | ||
Organism | Citrobacter freundii isolate 22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | LQ181_RS24085 | Protein ID | WP_003028682.1 |
Coordinates | 4934899..4935273 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | LQ181_RS24090 | Protein ID | WP_043018956.1 |
Coordinates | 4935273..4935515 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ181_RS24070 (4932402) | 4932402..4933304 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
LQ181_RS24075 (4933301) | 4933301..4933936 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQ181_RS24080 (4933933) | 4933933..4934862 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
LQ181_RS24085 (4934899) | 4934899..4935273 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ181_RS24090 (4935273) | 4935273..4935515 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
LQ181_RS24095 (4935721) | 4935721..4936629 | + | 909 | WP_044701816.1 | alpha/beta hydrolase | - |
LQ181_RS24100 (4936780) | 4936780..4937721 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
LQ181_RS24105 (4937766) | 4937766..4938203 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
LQ181_RS24110 (4938200) | 4938200..4939072 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
LQ181_RS24115 (4939066) | 4939066..4939665 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T295726 WP_003028682.1 NZ_OW849527:c4935273-4934899 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |