Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 4782966..4783632 | Replicon | chromosome |
| Accession | NZ_OW849527 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | A0A0D7LIM5 |
| Locus tag | LQ181_RS23400 | Protein ID | WP_044702260.1 |
| Coordinates | 4783273..4783632 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | A0A0D7LIR0 |
| Locus tag | LQ181_RS23395 | Protein ID | WP_003844682.1 |
| Coordinates | 4782966..4783283 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ181_RS23365 (4778633) | 4778633..4779457 | + | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| LQ181_RS23370 (4779526) | 4779526..4780749 | + | 1224 | WP_044702265.1 | L-sorbose 1-phosphate reductase | - |
| LQ181_RS23375 (4780751) | 4780751..4781563 | + | 813 | WP_044702264.1 | shikimate 5-dehydrogenase | - |
| LQ181_RS23380 (4781615) | 4781615..4781971 | - | 357 | WP_032948294.1 | hypothetical protein | - |
| LQ181_RS23385 (4782113) | 4782113..4782274 | + | 162 | WP_003841416.1 | phage protein | - |
| LQ181_RS23390 (4782678) | 4782678..4782956 | + | 279 | WP_044702262.1 | putative addiction module antidote protein | - |
| LQ181_RS23395 (4782966) | 4782966..4783283 | - | 318 | WP_003844682.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LQ181_RS23400 (4783273) | 4783273..4783632 | - | 360 | WP_044702260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ181_RS23405 (4783846) | 4783846..4784535 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
| LQ181_RS23410 (4784601) | 4784601..4786232 | - | 1632 | WP_032938230.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13437.49 Da Isoelectric Point: 10.2555
>T295725 WP_044702260.1 NZ_OW849527:c4783632-4783273 [Citrobacter freundii]
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LIM5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LIR0 |