Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 4045600..4046279 | Replicon | chromosome |
| Accession | NZ_OW849527 | ||
| Organism | Citrobacter freundii isolate 22 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
| Locus tag | LQ181_RS19860 | Protein ID | WP_003031349.1 |
| Coordinates | 4045938..4046279 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
| Locus tag | LQ181_RS19855 | Protein ID | WP_003031347.1 |
| Coordinates | 4045600..4045917 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ181_RS19830 (4041693) | 4041693..4043690 | - | 1998 | WP_016245729.1 | choline BCCT transporter BetT | - |
| LQ181_RS19835 (4044238) | 4044238..4044385 | + | 148 | Protein_3890 | hypothetical protein | - |
| LQ181_RS19840 (4044399) | 4044399..4044860 | + | 462 | WP_003031344.1 | antirestriction protein | - |
| LQ181_RS19845 (4044876) | 4044876..4045352 | + | 477 | WP_003031345.1 | RadC family protein | - |
| LQ181_RS19850 (4045361) | 4045361..4045582 | + | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
| LQ181_RS19855 (4045600) | 4045600..4045917 | + | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ181_RS19860 (4045938) | 4045938..4046279 | + | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| LQ181_RS19865 (4046869) | 4046869..4047471 | - | 603 | WP_224770543.1 | tail fiber assembly protein | - |
| LQ181_RS19870 (4047473) | 4047473..4048924 | - | 1452 | WP_224770544.1 | hypothetical protein | - |
| LQ181_RS19875 (4048924) | 4048924..4049604 | - | 681 | WP_121927014.1 | DUF2612 domain-containing protein | - |
| LQ181_RS19880 (4049601) | 4049601..4050800 | - | 1200 | WP_121927013.1 | baseplate J/gp47 family protein | - |
| LQ181_RS19885 (4050801) | 4050801..4051154 | - | 354 | WP_016239889.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T295723 WP_003031349.1 NZ_OW849527:4045938-4046279 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JLK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B7JLJ2 |