Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3809946..3810566 | Replicon | chromosome |
Accession | NZ_OW849527 | ||
Organism | Citrobacter freundii isolate 22 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | LQ181_RS18760 | Protein ID | WP_002892050.1 |
Coordinates | 3810348..3810566 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | LQ181_RS18755 | Protein ID | WP_003021733.1 |
Coordinates | 3809946..3810320 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ181_RS18745 (3805093) | 3805093..3806286 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ181_RS18750 (3806309) | 3806309..3809458 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
LQ181_RS18755 (3809946) | 3809946..3810320 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
LQ181_RS18760 (3810348) | 3810348..3810566 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
LQ181_RS18765 (3810873) | 3810873..3811424 | + | 552 | WP_044699372.1 | maltose O-acetyltransferase | - |
LQ181_RS18770 (3811541) | 3811541..3812011 | + | 471 | WP_003021724.1 | YlaC family protein | - |
LQ181_RS18775 (3812090) | 3812090..3812230 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
LQ181_RS18780 (3812232) | 3812232..3812492 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
LQ181_RS18785 (3812681) | 3812681..3814234 | + | 1554 | WP_044699371.1 | EAL domain-containing protein | - |
LQ181_RS18790 (3814286) | 3814286..3814639 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
LQ181_RS18795 (3814704) | 3814704..3815333 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295722 WP_002892050.1 NZ_OW849527:3810348-3810566 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT295722 WP_003021733.1 NZ_OW849527:3809946-3810320 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |