Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 882686..883340 | Replicon | chromosome |
Accession | NZ_OW849527 | ||
Organism | Citrobacter freundii isolate 22 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | LQ181_RS04370 | Protein ID | WP_003026936.1 |
Coordinates | 882933..883340 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | LQ181_RS04365 | Protein ID | WP_003026938.1 |
Coordinates | 882686..882952 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ181_RS04340 (877887) | 877887..879320 | - | 1434 | WP_044700805.1 | 6-phospho-beta-glucosidase BglA | - |
LQ181_RS04345 (879441) | 879441..880169 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
LQ181_RS04350 (880222) | 880222..880533 | + | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ181_RS04355 (880696) | 880696..881355 | + | 660 | WP_003838267.1 | hemolysin III family protein | - |
LQ181_RS04360 (881449) | 881449..882429 | - | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
LQ181_RS04365 (882686) | 882686..882952 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
LQ181_RS04370 (882933) | 882933..883340 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
LQ181_RS04375 (883385) | 883385..883906 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
LQ181_RS04380 (884020) | 884020..884916 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
LQ181_RS04385 (884940) | 884940..885653 | + | 714 | WP_003026923.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ181_RS04390 (885659) | 885659..887392 | + | 1734 | WP_044700800.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T295717 WP_003026936.1 NZ_OW849527:882933-883340 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |