Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 188739..189382 Replicon plasmid P1
Accession NZ_OW849471
Organism Klebsiella oxytoca isolate 325

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag LQ213_RS28250 Protein ID WP_014386165.1
Coordinates 188966..189382 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag LQ213_RS28245 Protein ID WP_032408893.1
Coordinates 188739..188969 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ213_RS28220 (AI2699V1_5482) 183812..184795 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
LQ213_RS28225 (AI2699V1_5483) 184814..185962 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
LQ213_RS28230 (AI2699V1_5484) 186133..187290 - 1158 WP_032408895.1 acetylornithine deacetylase -
LQ213_RS28235 (AI2699V1_5485) 187306..187980 - 675 WP_014386166.1 DUF1028 domain-containing protein -
LQ213_RS28240 (AI2699V1_5486) 187985..188419 - 435 WP_000103648.1 RidA family protein -
LQ213_RS28245 (AI2699V1_5487) 188739..188969 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ213_RS28250 (AI2699V1_5488) 188966..189382 + 417 WP_014386165.1 PIN domain-containing protein Toxin
LQ213_RS28255 (AI2699V1_5489) 189705..190673 + 969 WP_074422984.1 IS5-like element IS903B family transposase -
LQ213_RS28260 (AI2699V1_5490) 190853..191227 - 375 WP_032408891.1 hypothetical protein -
LQ213_RS28265 (AI2699V1_5491) 191283..191609 - 327 WP_004152639.1 hypothetical protein -
LQ213_RS28270 (AI2699V1_5492) 191606..192334 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
LQ213_RS28275 (AI2699V1_5493) 192331..192762 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA12 / aadA2 / qacE / sul1 / mph(A) / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / aph(3')-Ia - 1..209598 209598
- flank IS/Tn - - 189705..190673 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T295713 WP_014386165.1 NZ_OW849471:188966-189382 [Klebsiella oxytoca]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT295713 WP_032408893.1 NZ_OW849471:188739-188969 [Klebsiella oxytoca]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References