Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 164843..165588 Replicon plasmid P1
Accession NZ_OW849471
Organism Klebsiella oxytoca isolate 325

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag LQ213_RS28120 Protein ID WP_032408901.1
Coordinates 165097..165588 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag LQ213_RS28115 Protein ID WP_014386183.1
Coordinates 164843..165109 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ213_RS28065 (AI2699V1_5449) 160395..160808 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
LQ213_RS28070 (AI2699V1_5450) 160809..161087 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
LQ213_RS28075 (AI2699V1_5451) 161077..161397 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
LQ213_RS28080 (AI2699V1_5452) 161478..161702 - 225 WP_014386189.1 hypothetical protein -
LQ213_RS28085 (AI2699V1_5453) 161713..161925 - 213 WP_014386188.1 hypothetical protein -
LQ213_RS28090 (AI2699V1_5454) 161987..162313 - 327 WP_014386187.1 hypothetical protein -
LQ213_RS28095 (AI2699V1_5455) 162950..163300 - 351 WP_014386186.1 hypothetical protein -
LQ213_RS28100 (AI2699V1_5456) 163297..163569 - 273 WP_032408902.1 hypothetical protein -
LQ213_RS28105 (AI2699V1_5457) 163759..164244 + 486 WP_014386185.1 hypothetical protein -
LQ213_RS28110 (AI2699V1_5458) 164488..164646 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
LQ213_RS28115 (AI2699V1_5459) 164843..165109 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
LQ213_RS28120 (AI2699V1_5460) 165097..165588 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
LQ213_RS28125 (AI2699V1_5461) 166029..166280 - 252 WP_032408900.1 aldo/keto reductase -
LQ213_RS28130 (AI2699V1_5462) 166477..168069 - 1593 Protein_183 IS66 family transposase -
LQ213_RS28135 (AI2699V1_5464) 168100..168450 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
LQ213_RS28140 (AI2699V1_5465) 168447..168887 - 441 WP_014386179.1 transposase -
LQ213_RS28145 (AI2699V1_5466) 169149..169904 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA12 / aadA2 / qacE / sul1 / mph(A) / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / aph(3')-Ia - 1..209598 209598


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T295712 WP_032408901.1 NZ_OW849471:165097-165588 [Klebsiella oxytoca]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT295712 WP_014386183.1 NZ_OW849471:164843-165109 [Klebsiella oxytoca]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References