Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 164843..165588 | Replicon | plasmid P1 |
| Accession | NZ_OW849471 | ||
| Organism | Klebsiella oxytoca isolate 325 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A331KSM6 |
| Locus tag | LQ213_RS28120 | Protein ID | WP_032408901.1 |
| Coordinates | 165097..165588 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | LQ213_RS28115 | Protein ID | WP_014386183.1 |
| Coordinates | 164843..165109 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ213_RS28065 (AI2699V1_5449) | 160395..160808 | - | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
| LQ213_RS28070 (AI2699V1_5450) | 160809..161087 | - | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
| LQ213_RS28075 (AI2699V1_5451) | 161077..161397 | - | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LQ213_RS28080 (AI2699V1_5452) | 161478..161702 | - | 225 | WP_014386189.1 | hypothetical protein | - |
| LQ213_RS28085 (AI2699V1_5453) | 161713..161925 | - | 213 | WP_014386188.1 | hypothetical protein | - |
| LQ213_RS28090 (AI2699V1_5454) | 161987..162313 | - | 327 | WP_014386187.1 | hypothetical protein | - |
| LQ213_RS28095 (AI2699V1_5455) | 162950..163300 | - | 351 | WP_014386186.1 | hypothetical protein | - |
| LQ213_RS28100 (AI2699V1_5456) | 163297..163569 | - | 273 | WP_032408902.1 | hypothetical protein | - |
| LQ213_RS28105 (AI2699V1_5457) | 163759..164244 | + | 486 | WP_014386185.1 | hypothetical protein | - |
| LQ213_RS28110 (AI2699V1_5458) | 164488..164646 | - | 159 | WP_014386184.1 | type I toxin-antitoxin system Hok family toxin | - |
| LQ213_RS28115 (AI2699V1_5459) | 164843..165109 | + | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ213_RS28120 (AI2699V1_5460) | 165097..165588 | + | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
| LQ213_RS28125 (AI2699V1_5461) | 166029..166280 | - | 252 | WP_032408900.1 | aldo/keto reductase | - |
| LQ213_RS28130 (AI2699V1_5462) | 166477..168069 | - | 1593 | Protein_183 | IS66 family transposase | - |
| LQ213_RS28135 (AI2699V1_5464) | 168100..168450 | - | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| LQ213_RS28140 (AI2699V1_5465) | 168447..168887 | - | 441 | WP_014386179.1 | transposase | - |
| LQ213_RS28145 (AI2699V1_5466) | 169149..169904 | - | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / sul1 / mph(A) / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / aph(3')-Ia | - | 1..209598 | 209598 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T295712 WP_032408901.1 NZ_OW849471:165097-165588 [Klebsiella oxytoca]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|