Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53667..54403 Replicon plasmid P1
Accession NZ_OW849471
Organism Klebsiella oxytoca isolate 325

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag LQ213_RS27495 Protein ID WP_003026803.1
Coordinates 53921..54403 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag LQ213_RS27490 Protein ID WP_003026799.1
Coordinates 53667..53933 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ213_RS27445 (AI2699V1_5331) 49729..50091 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
LQ213_RS27450 (AI2699V1_5332) 50141..50491 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
LQ213_RS27455 (AI2699V1_5333) 50849..51118 + 270 WP_004152102.1 hypothetical protein -
LQ213_RS27460 (AI2699V1_5334) 51106..51681 + 576 WP_004152103.1 hypothetical protein -
LQ213_RS27465 (AI2699V1_5335) 51712..52206 + 495 WP_004152104.1 DNA-binding protein -
LQ213_RS27470 (AI2699V1_5336) 52250..52618 + 369 WP_004152105.1 hypothetical protein -
LQ213_RS27475 (AI2699V1_5337) 52652..52855 + 204 WP_004152106.1 HHA domain-containing protein -
LQ213_RS27480 (AI2699V1_5338) 52904..53161 + 258 WP_004152107.1 hypothetical protein -
LQ213_RS27485 (AI2699V1_5339) 53237..53491 + 255 WP_004152108.1 hypothetical protein -
LQ213_RS27490 (AI2699V1_5340) 53667..53933 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
LQ213_RS27495 (AI2699V1_5341) 53921..54403 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
LQ213_RS27500 (AI2699V1_5342) 54589..54987 - 399 WP_032422684.1 helix-turn-helix domain-containing protein -
LQ213_RS27505 (AI2699V1_5343) 55036..56382 - 1347 WP_077255522.1 ISNCY family transposase -
LQ213_RS27510 (AI2699V1_5344) 56600..57946 + 1347 WP_020314316.1 ISNCY family transposase -
LQ213_RS27515 58107..58238 + 132 WP_004218042.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA12 / aadA2 / qacE / sul1 / mph(A) / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / aph(3')-Ia - 1..209598 209598


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T295711 WP_003026803.1 NZ_OW849471:53921-54403 [Klebsiella oxytoca]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT295711 WP_003026799.1 NZ_OW849471:53667-53933 [Klebsiella oxytoca]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References