Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4370281..4370900 | Replicon | chromosome |
Accession | NZ_OW849470 | ||
Organism | Klebsiella oxytoca isolate 325 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | LQ213_RS20550 | Protein ID | WP_004099646.1 |
Coordinates | 4370682..4370900 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | LQ213_RS20545 | Protein ID | WP_004099648.1 |
Coordinates | 4370281..4370655 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ213_RS20535 (AI2699V1_4001) | 4365437..4366630 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ213_RS20540 (AI2699V1_4002) | 4366653..4369799 | + | 3147 | WP_064371881.1 | multidrug efflux RND transporter permease subunit AcrB | - |
LQ213_RS20545 (AI2699V1_4003) | 4370281..4370655 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
LQ213_RS20550 (AI2699V1_4004) | 4370682..4370900 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
LQ213_RS20555 (AI2699V1_4005) | 4371061..4371627 | + | 567 | WP_004099644.1 | maltose O-acetyltransferase | - |
LQ213_RS20560 | 4371596..4371733 | - | 138 | WP_227629809.1 | hypothetical protein | - |
LQ213_RS20565 (AI2699V1_4006) | 4371764..4372234 | + | 471 | WP_004111038.1 | YlaC family protein | - |
LQ213_RS20570 (AI2699V1_4007) | 4372209..4373663 | - | 1455 | WP_064371883.1 | PLP-dependent aminotransferase family protein | - |
LQ213_RS20575 (AI2699V1_4008) | 4373766..4374464 | + | 699 | WP_064371884.1 | GNAT family protein | - |
LQ213_RS20580 (AI2699V1_4009) | 4374461..4374601 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
LQ213_RS20585 (AI2699V1_4010) | 4374601..4374864 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T295709 WP_004099646.1 NZ_OW849470:4370682-4370900 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT295709 WP_004099648.1 NZ_OW849470:4370281-4370655 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|