Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 886758..887415 | Replicon | chromosome |
Accession | NZ_OW849470 | ||
Organism | Klebsiella oxytoca isolate 325 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A181X6I0 |
Locus tag | LQ213_RS04240 | Protein ID | WP_004105559.1 |
Coordinates | 887005..887415 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A285B945 |
Locus tag | LQ213_RS04235 | Protein ID | WP_004105561.1 |
Coordinates | 886758..887024 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ213_RS04210 (AI2699V1_0821) | 881937..883370 | - | 1434 | WP_064372034.1 | 6-phospho-beta-glucosidase | - |
LQ213_RS04215 (AI2699V1_0822) | 883491..884219 | - | 729 | WP_064352017.1 | MurR/RpiR family transcriptional regulator | - |
LQ213_RS04220 (AI2699V1_0823) | 884270..884581 | + | 312 | WP_064372033.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ213_RS04225 (AI2699V1_0824) | 884743..885402 | + | 660 | WP_004105569.1 | hemolysin III family protein | - |
LQ213_RS04230 (AI2699V1_0825) | 885531..886514 | - | 984 | WP_064372032.1 | tRNA-modifying protein YgfZ | - |
LQ213_RS04235 (AI2699V1_0827) | 886758..887024 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
LQ213_RS04240 (AI2699V1_0828) | 887005..887415 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
LQ213_RS04245 (AI2699V1_0829) | 887424..887945 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
LQ213_RS04250 (AI2699V1_0830) | 888067..888963 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
LQ213_RS04255 (AI2699V1_0831) | 888986..889699 | + | 714 | WP_004105554.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ213_RS04260 (AI2699V1_0832) | 889705..891438 | + | 1734 | WP_004105553.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T295704 WP_004105559.1 NZ_OW849470:887005-887415 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A181X6I0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285B945 |