Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 669878..670470 | Replicon | chromosome |
Accession | NZ_OW849470 | ||
Organism | Klebsiella oxytoca isolate 325 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | LQ213_RS03205 | Protein ID | WP_016808034.1 |
Coordinates | 670096..670470 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A2J4YM08 |
Locus tag | LQ213_RS03200 | Protein ID | WP_004105957.1 |
Coordinates | 669878..670099 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ213_RS03180 (AI2699V1_0619) | 665439..665993 | + | 555 | WP_004105965.1 | YgjV family protein | - |
LQ213_RS03185 (AI2699V1_0620) | 666008..667255 | - | 1248 | WP_004105963.1 | serine/threonine transporter SstT | - |
LQ213_RS03190 (AI2699V1_0621) | 667510..668478 | - | 969 | WP_004105962.1 | TerC family protein | - |
LQ213_RS03195 (AI2699V1_0622) | 668729..669718 | - | 990 | WP_204724101.1 | Gfo/Idh/MocA family oxidoreductase | - |
LQ213_RS03200 (AI2699V1_0623) | 669878..670099 | + | 222 | WP_004105957.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
LQ213_RS03205 (AI2699V1_0624) | 670096..670470 | + | 375 | WP_016808034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
LQ213_RS03210 (AI2699V1_0625) | 670450..670953 | - | 504 | WP_004105953.1 | M48 family metallopeptidase | - |
LQ213_RS03215 (AI2699V1_0626) | 671032..672675 | - | 1644 | WP_064373438.1 | glycoside hydrolase family 43 protein | - |
LQ213_RS03220 (AI2699V1_0627) | 672804..673670 | - | 867 | WP_004105950.1 | AraC family transcriptional regulator | - |
LQ213_RS03225 (AI2699V1_0628) | 673778..675121 | + | 1344 | WP_016808032.1 | glycoside-pentoside-hexuronide (GPH):cation symporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13835.89 Da Isoelectric Point: 6.0752
>T295703 WP_016808034.1 NZ_OW849470:670096-670470 [Klebsiella oxytoca]
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHCEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHCEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|