Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4190952..4191547 | Replicon | chromosome |
Accession | NZ_OW849377 | ||
Organism | Escherichia coli isolate 162 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | LQ158_RS20120 | Protein ID | WP_000239579.1 |
Coordinates | 4190952..4191302 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | A0A4D0VVQ9 |
Locus tag | LQ158_RS20125 | Protein ID | WP_001223207.1 |
Coordinates | 4191296..4191547 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ158_RS20100 (4186228) | 4186228..4187250 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
LQ158_RS20105 (4187264) | 4187264..4188766 | - | 1503 | WP_000205795.1 | sugar ABC transporter ATP-binding protein | - |
LQ158_RS20110 (4189076) | 4189076..4190032 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
LQ158_RS20115 (4190342) | 4190342..4190872 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
LQ158_RS20120 (4190952) | 4190952..4191302 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
LQ158_RS20125 (4191296) | 4191296..4191547 | - | 252 | WP_001223207.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
LQ158_RS20130 (4191760) | 4191760..4192101 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
LQ158_RS20135 (4192104) | 4192104..4195883 | - | 3780 | WP_000060927.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T295691 WP_000239579.1 NZ_OW849377:c4191302-4190952 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D0VVQ9 |