Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 4115477..4116252 | Replicon | chromosome |
| Accession | NZ_OW849377 | ||
| Organism | Escherichia coli isolate 162 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A7V7JG91 |
| Locus tag | LQ158_RS19775 | Protein ID | WP_001193488.1 |
| Coordinates | 4115477..4115848 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7V7JFU6 |
| Locus tag | LQ158_RS19780 | Protein ID | WP_001059301.1 |
| Coordinates | 4115887..4116252 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ158_RS19750 (4110559) | 4110559..4111665 | + | 1107 | WP_001044128.1 | N-acetylneuraminate epimerase | - |
| LQ158_RS19755 (4111730) | 4111730..4112710 | + | 981 | WP_001366032.1 | sialate O-acetylesterase | - |
| LQ158_RS19760 (4112718) | 4112718..4112822 | - | 105 | Protein_3877 | HNH endonuclease | - |
| LQ158_RS19765 (4112922) | 4112922..4113794 | + | 873 | WP_000168567.1 | HNH endonuclease | - |
| LQ158_RS19770 (4113905) | 4113905..4114903 | - | 999 | WP_001240355.1 | membrane protein | - |
| LQ158_RS19775 (4115477) | 4115477..4115848 | - | 372 | WP_001193488.1 | TA system toxin CbtA family protein | Toxin |
| LQ158_RS19780 (4115887) | 4115887..4116252 | - | 366 | WP_001059301.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ158_RS19785 (4116278) | 4116278..4116499 | - | 222 | WP_000691983.1 | DUF987 domain-containing protein | - |
| LQ158_RS19790 (4116496) | 4116496..4117038 | - | 543 | WP_015740440.1 | DNA repair protein RadC | - |
| LQ158_RS19795 (4117051) | 4117051..4117494 | - | 444 | WP_001096016.1 | antirestriction protein | - |
| LQ158_RS19800 (4117525) | 4117525..4118346 | - | 822 | WP_001234409.1 | DUF932 domain-containing protein | - |
| LQ158_RS19805 (4118466) | 4118466..4118939 | - | 474 | WP_001298943.1 | hypothetical protein | - |
| LQ158_RS19810 (4119011) | 4119011..4119463 | - | 453 | WP_000734321.1 | hypothetical protein | - |
| LQ158_RS19815 (4119499) | 4119499..4120215 | - | 717 | WP_000174910.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4107766..4125582 | 17816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13832.94 Da Isoelectric Point: 7.2419
>T295690 WP_001193488.1 NZ_OW849377:c4115848-4115477 [Escherichia coli]
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
Download Length: 372 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13388.25 Da Isoelectric Point: 5.9530
>AT295690 WP_001059301.1 NZ_OW849377:c4116252-4115887 [Escherichia coli]
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JG91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JFU6 |