Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3550539..3551376 | Replicon | chromosome |
| Accession | NZ_OW849377 | ||
| Organism | Escherichia coli isolate 162 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | LQ158_RS17185 | Protein ID | WP_000227784.1 |
| Coordinates | 3550834..3551376 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | LQ158_RS17180 | Protein ID | WP_001297137.1 |
| Coordinates | 3550539..3550850 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ158_RS17155 (3545559) | 3545559..3546506 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| LQ158_RS17160 (3546528) | 3546528..3548519 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| LQ158_RS17165 (3548509) | 3548509..3549123 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| LQ158_RS17170 (3549123) | 3549123..3549452 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| LQ158_RS17175 (3549464) | 3549464..3550354 | + | 891 | WP_000971336.1 | heme o synthase | - |
| LQ158_RS17180 (3550539) | 3550539..3550850 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ158_RS17185 (3550834) | 3550834..3551376 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| LQ158_RS17190 (3551432) | 3551432..3552367 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| LQ158_RS17195 (3552775) | 3552775..3554139 | + | 1365 | WP_023143167.1 | MFS transporter | - |
| LQ158_RS17200 (3554267) | 3554267..3554758 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| LQ158_RS17205 (3554926) | 3554926..3555837 | + | 912 | WP_000705877.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T295688 WP_000227784.1 NZ_OW849377:3550834-3551376 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|