Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 781265..782100 | Replicon | chromosome |
| Accession | NZ_OW849377 | ||
| Organism | Escherichia coli isolate 162 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | LQ158_RS03805 | Protein ID | WP_063090830.1 |
| Coordinates | 781265..781642 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | LQ158_RS03810 | Protein ID | WP_024174331.1 |
| Coordinates | 781732..782100 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ158_RS03775 (776673) | 776673..777650 | + | 978 | WP_000633235.1 | type II secretion system minor pseudopilin GspK | - |
| LQ158_RS03780 (777647) | 777647..778825 | + | 1179 | WP_000094957.1 | type II secretion system protein GspL | - |
| LQ158_RS03785 (778827) | 778827..779363 | + | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| LQ158_RS03790 (779644) | 779644..780486 | - | 843 | WP_042096658.1 | DUF4942 domain-containing protein | - |
| LQ158_RS03795 (780571) | 780571..780768 | - | 198 | WP_000838536.1 | DUF957 domain-containing protein | - |
| LQ158_RS03800 (780780) | 780780..781268 | - | 489 | WP_042096656.1 | DUF5983 family protein | - |
| LQ158_RS03805 (781265) | 781265..781642 | - | 378 | WP_063090830.1 | TA system toxin CbtA family protein | Toxin |
| LQ158_RS03810 (781732) | 781732..782100 | - | 369 | WP_024174331.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ158_RS03815 (782174) | 782174..782395 | - | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| LQ158_RS03820 (782464) | 782464..782940 | - | 477 | WP_001186725.1 | RadC family protein | - |
| LQ158_RS03825 (782956) | 782956..783441 | - | 486 | WP_042096390.1 | antirestriction protein | - |
| LQ158_RS03830 (783533) | 783533..784351 | - | 819 | WP_001234749.1 | DUF932 domain-containing protein | - |
| LQ158_RS03835 (784442) | 784442..784675 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14210.15 Da Isoelectric Point: 6.8518
>T295677 WP_063090830.1 NZ_OW849377:c781642-781265 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLGF
SACTRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLGF
SACTRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13603.42 Da Isoelectric Point: 6.7386
>AT295677 WP_024174331.1 NZ_OW849377:c782100-781732 [Escherichia coli]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|