Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4153757..4154436 | Replicon | chromosome |
| Accession | NZ_OW849195 | ||
| Organism | Enterobacter cloacae isolate 125 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | LQ145_RS20115 | Protein ID | WP_014641112.1 |
| Coordinates | 4153757..4154098 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | LQ145_RS20120 | Protein ID | WP_001004647.1 |
| Coordinates | 4154119..4154436 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ145_RS20095 (AI2762V1_3920) | 4149031..4150776 | + | 1746 | WP_014885284.1 | DNA primase | - |
| LQ145_RS20100 (AI2762V1_3921) | 4150942..4152786 | + | 1845 | WP_014885285.1 | RNA polymerase sigma factor RpoD | - |
| LQ145_RS20105 (AI2762V1_3922) | 4152888..4153394 | - | 507 | WP_014885286.1 | G/U mismatch-specific DNA glycosylase | - |
| LQ145_RS20115 (AI2762V1_3923) | 4153757..4154098 | - | 342 | WP_014641112.1 | TA system toxin CbtA family protein | Toxin |
| LQ145_RS20120 (AI2762V1_3924) | 4154119..4154436 | - | 318 | WP_001004647.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ145_RS20125 (AI2762V1_3925) | 4154465..4154947 | - | 483 | WP_180837426.1 | DNA repair protein RadC | - |
| LQ145_RS20130 (AI2762V1_3926) | 4154956..4155414 | - | 459 | WP_000211839.1 | antirestriction protein | - |
| LQ145_RS20135 (AI2762V1_3927) | 4155516..4155755 | - | 240 | WP_001115184.1 | DUF905 domain-containing protein | - |
| LQ145_RS20140 (AI2762V1_3928) | 4155846..4159313 | - | 3468 | WP_283942670.1 | AIDA repeat-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13031.28 Da Isoelectric Point: 10.5786
>T295673 WP_014641112.1 NZ_OW849195:c4154098-4153757 [Enterobacter cloacae]
MKTLPATTLRVVKPCLSPVAVWKMLLTRLLEQHYGLTLNDTPFSKERVIQEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRKNLVR
MKTLPATTLRVVKPCLSPVAVWKMLLTRLLEQHYGLTLNDTPFSKERVIQEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRKNLVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|