Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3942295..3942952 | Replicon | chromosome |
| Accession | NZ_OW849195 | ||
| Organism | Enterobacter cloacae isolate 125 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2W0G6Z0 |
| Locus tag | LQ145_RS19120 | Protein ID | WP_014885136.1 |
| Coordinates | 3942295..3942705 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V3PWU7 |
| Locus tag | LQ145_RS19125 | Protein ID | WP_010435322.1 |
| Coordinates | 3942686..3942952 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ145_RS19100 (AI2762V1_3727) | 3938289..3940022 | - | 1734 | WP_023331239.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LQ145_RS19105 (AI2762V1_3728) | 3940028..3940741 | - | 714 | WP_014885133.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ145_RS19110 (AI2762V1_3729) | 3940770..3941666 | - | 897 | WP_014885134.1 | site-specific tyrosine recombinase XerD | - |
| LQ145_RS19115 (AI2762V1_3730) | 3941768..3942289 | + | 522 | WP_014885135.1 | flavodoxin FldB | - |
| LQ145_RS19120 (AI2762V1_3731) | 3942295..3942705 | - | 411 | WP_014885136.1 | protein YgfX | Toxin |
| LQ145_RS19125 (AI2762V1_3732) | 3942686..3942952 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
| LQ145_RS19130 (AI2762V1_3733) | 3943247..3944227 | + | 981 | WP_023331241.1 | tRNA-modifying protein YgfZ | - |
| LQ145_RS19135 (AI2762V1_3734) | 3944312..3944971 | - | 660 | WP_023331242.1 | hemolysin III family protein | - |
| LQ145_RS19140 (AI2762V1_3735) | 3945237..3945968 | + | 732 | WP_014885139.1 | MurR/RpiR family transcriptional regulator | - |
| LQ145_RS19145 (AI2762V1_3736) | 3946085..3947518 | + | 1434 | WP_023331244.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16135.04 Da Isoelectric Point: 10.7510
>T295672 WP_014885136.1 NZ_OW849195:c3942705-3942295 [Enterobacter cloacae]
VVLWQSDLRVSWRSQWMSLMLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNSGMMLRLRNVDGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
VVLWQSDLRVSWRSQWMSLMLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNSGMMLRLRNVDGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W0G6Z0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PWU7 |