Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1110936..1111556 | Replicon | chromosome |
| Accession | NZ_OW849195 | ||
| Organism | Enterobacter cloacae isolate 125 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A2W0G488 |
| Locus tag | LQ145_RS05330 | Protein ID | WP_014882802.1 |
| Coordinates | 1110936..1111154 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | LQ145_RS05335 | Protein ID | WP_008499288.1 |
| Coordinates | 1111182..1111556 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ145_RS05300 (AI2762V1_1030) | 1106945..1107205 | + | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
| LQ145_RS05305 (AI2762V1_1031) | 1107208..1107348 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LQ145_RS05310 (AI2762V1_1032) | 1107345..1108055 | - | 711 | WP_014882798.1 | GNAT family protein | - |
| LQ145_RS05315 (AI2762V1_1033) | 1108157..1109617 | + | 1461 | Protein_1032 | PLP-dependent aminotransferase family protein | - |
| LQ145_RS05320 (AI2762V1_1034) | 1109589..1110056 | - | 468 | WP_014882800.1 | YlaC family protein | - |
| LQ145_RS05325 (AI2762V1_1035) | 1110175..1110726 | - | 552 | WP_014882801.1 | maltose O-acetyltransferase | - |
| LQ145_RS05330 (AI2762V1_1036) | 1110936..1111154 | - | 219 | WP_014882802.1 | HHA domain-containing protein | Toxin |
| LQ145_RS05335 (AI2762V1_1037) | 1111182..1111556 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ145_RS05340 (AI2762V1_1038) | 1112068..1115214 | - | 3147 | WP_014882803.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQ145_RS05345 (AI2762V1_1039) | 1115237..1116430 | - | 1194 | WP_014882804.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T295665 WP_014882802.1 NZ_OW849195:c1111154-1110936 [Enterobacter cloacae]
MSEKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSEKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT295665 WP_008499288.1 NZ_OW849195:c1111556-1111182 [Enterobacter cloacae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W0G488 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |