Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 453769..454364 | Replicon | chromosome |
| Accession | NZ_OW849195 | ||
| Organism | Enterobacter cloacae isolate 125 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | LQ145_RS02145 | Protein ID | WP_023331877.1 |
| Coordinates | 454014..454364 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | LQ145_RS02140 | Protein ID | WP_023331876.1 |
| Coordinates | 453769..454020 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ145_RS02130 (AI2762V1_0414) | 449436..453212 | + | 3777 | WP_023331875.1 | autotransporter assembly complex protein TamB | - |
| LQ145_RS02135 (AI2762V1_0415) | 453215..453559 | + | 345 | WP_014882267.1 | gamma-glutamylcyclotransferase | - |
| LQ145_RS02140 (AI2762V1_0416) | 453769..454020 | + | 252 | WP_023331876.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| LQ145_RS02145 (AI2762V1_0417) | 454014..454364 | + | 351 | WP_023331877.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| LQ145_RS02150 (AI2762V1_0418) | 454442..454972 | - | 531 | WP_008501423.1 | inorganic diphosphatase | - |
| LQ145_RS02155 (AI2762V1_0419) | 455282..456238 | + | 957 | WP_014882271.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| LQ145_RS02160 (AI2762V1_0420) | 456370..457872 | + | 1503 | WP_023331878.1 | sugar ABC transporter ATP-binding protein | - |
| LQ145_RS02165 (AI2762V1_0421) | 457883..458908 | + | 1026 | WP_014882273.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12339.36 Da Isoelectric Point: 6.9493
>T295664 WP_023331877.1 NZ_OW849195:454014-454364 [Enterobacter cloacae]
MVKRPCFERGDIVLVGFDPANGHEQKGAGRPALVLSVSAFNQLGMTLVAPVTQGGNFARYAGFSVPLSCEEGNILGVILV
NQIRMMDLGARLAKRIGVASDETVEDALLRLQAILS
MVKRPCFERGDIVLVGFDPANGHEQKGAGRPALVLSVSAFNQLGMTLVAPVTQGGNFARYAGFSVPLSCEEGNILGVILV
NQIRMMDLGARLAKRIGVASDETVEDALLRLQAILS
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|