Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4684415..4685031 | Replicon | chromosome |
| Accession | NZ_OW849099 | ||
| Organism | Citrobacter freundii isolate 402 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
| Locus tag | LQ100_RS22365 | Protein ID | WP_003028682.1 |
| Coordinates | 4684415..4684789 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | LQ100_RS22370 | Protein ID | WP_161958353.1 |
| Coordinates | 4684789..4685031 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ100_RS22350 (4681918) | 4681918..4682820 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| LQ100_RS22355 (4682817) | 4682817..4683452 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQ100_RS22360 (4683449) | 4683449..4684378 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| LQ100_RS22365 (4684415) | 4684415..4684789 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ100_RS22370 (4684789) | 4684789..4685031 | - | 243 | WP_161958353.1 | CopG family transcriptional regulator | Antitoxin |
| LQ100_RS22375 (4685238) | 4685238..4686146 | + | 909 | WP_060854620.1 | alpha/beta hydrolase | - |
| LQ100_RS22380 (4686297) | 4686297..4687238 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| LQ100_RS22385 (4687283) | 4687283..4687720 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| LQ100_RS22390 (4687717) | 4687717..4688589 | - | 873 | WP_060854619.1 | virulence factor BrkB family protein | - |
| LQ100_RS22395 (4688583) | 4688583..4689182 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T295662 WP_003028682.1 NZ_OW849099:c4684789-4684415 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|