Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4278895..4279411 | Replicon | chromosome |
Accession | NZ_OW849099 | ||
Organism | Citrobacter freundii isolate 402 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A133L8K5 |
Locus tag | LQ100_RS20465 | Protein ID | WP_003844927.1 |
Coordinates | 4278895..4279179 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | LQ100_RS20470 | Protein ID | WP_003839576.1 |
Coordinates | 4279169..4279411 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ100_RS20450 (4274121) | 4274121..4275773 | + | 1653 | WP_230142563.1 | alpha,alpha-phosphotrehalase | - |
LQ100_RS20455 (4276182) | 4276182..4278320 | + | 2139 | WP_003844922.1 | anaerobic ribonucleoside-triphosphate reductase | - |
LQ100_RS20460 (4278427) | 4278427..4278891 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
LQ100_RS20465 (4278895) | 4278895..4279179 | - | 285 | WP_003844927.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ100_RS20470 (4279169) | 4279169..4279411 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LQ100_RS20475 (4279489) | 4279489..4281402 | - | 1914 | WP_003844930.1 | BglG family transcription antiterminator | - |
LQ100_RS20480 (4281424) | 4281424..4282164 | - | 741 | WP_048216922.1 | KDGP aldolase family protein | - |
LQ100_RS20485 (4282161) | 4282161..4283279 | - | 1119 | WP_048216923.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
LQ100_RS20490 (4283263) | 4283263..4284396 | - | 1134 | WP_060855415.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10892.76 Da Isoelectric Point: 10.0482
>T295661 WP_003844927.1 NZ_OW849099:c4279179-4278895 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLLYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLLYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A133L8K5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |