Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3578089..3578709 | Replicon | chromosome |
| Accession | NZ_OW849099 | ||
| Organism | Citrobacter freundii isolate 402 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | LQ100_RS17230 | Protein ID | WP_002892050.1 |
| Coordinates | 3578491..3578709 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | LQ100_RS17225 | Protein ID | WP_003021733.1 |
| Coordinates | 3578089..3578463 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ100_RS17215 (3573236) | 3573236..3574429 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ100_RS17220 (3574452) | 3574452..3577601 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| LQ100_RS17225 (3578089) | 3578089..3578463 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ100_RS17230 (3578491) | 3578491..3578709 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| LQ100_RS17235 (3579016) | 3579016..3579567 | + | 552 | WP_032936967.1 | maltose O-acetyltransferase | - |
| LQ100_RS17240 (3579684) | 3579684..3580154 | + | 471 | WP_003021724.1 | YlaC family protein | - |
| LQ100_RS17245 (3580233) | 3580233..3580373 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| LQ100_RS17250 (3580375) | 3580375..3580635 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
| LQ100_RS17255 (3580824) | 3580824..3582377 | + | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
| LQ100_RS17260 (3582429) | 3582429..3582782 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| LQ100_RS17265 (3582847) | 3582847..3583476 | - | 630 | WP_003021707.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295660 WP_002892050.1 NZ_OW849099:3578491-3578709 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT295660 WP_003021733.1 NZ_OW849099:3578089-3578463 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |