Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2890536..2891126 | Replicon | chromosome |
Accession | NZ_OW849099 | ||
Organism | Citrobacter freundii isolate 402 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A0J1NBD3 |
Locus tag | LQ100_RS13965 | Protein ID | WP_003836692.1 |
Coordinates | 2890536..2890868 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0J1NBD4 |
Locus tag | LQ100_RS13970 | Protein ID | WP_003836694.1 |
Coordinates | 2890869..2891126 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ100_RS13940 (2886289) | 2886289..2887776 | + | 1488 | WP_003846749.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
LQ100_RS13950 (2888092) | 2888092..2889042 | - | 951 | WP_016149950.1 | HTH-type transcriptional regulator Cbl | - |
LQ100_RS13955 (2889144) | 2889144..2890061 | - | 918 | WP_054528287.1 | nitrogen assimilation transcriptional regulator NAC | - |
LQ100_RS13965 (2890536) | 2890536..2890868 | - | 333 | WP_003836692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
LQ100_RS13970 (2890869) | 2890869..2891126 | - | 258 | WP_003836694.1 | hypothetical protein | Antitoxin |
LQ100_RS13975 (2891740) | 2891740..2895639 | + | 3900 | WP_060855256.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2880139..2901508 | 21369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11703.48 Da Isoelectric Point: 8.5572
>T295659 WP_003836692.1 NZ_OW849099:c2890868-2890536 [Citrobacter freundii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD4 |