Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2374731..2375370 | Replicon | chromosome |
| Accession | NZ_OW849099 | ||
| Organism | Citrobacter freundii isolate 402 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8B5QF36 |
| Locus tag | LQ100_RS11470 | Protein ID | WP_003020221.1 |
| Coordinates | 2374731..2374907 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LQ100_RS11475 | Protein ID | WP_123924900.1 |
| Coordinates | 2374954..2375370 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ100_RS11450 (2371509) | 2371509..2371739 | - | 231 | WP_048217543.1 | DUF2554 family protein | - |
| LQ100_RS11455 (2371929) | 2371929..2372054 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| LQ100_RS11460 (2372054) | 2372054..2373064 | - | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
| LQ100_RS11465 (2373064) | 2373064..2374467 | - | 1404 | WP_003020224.1 | cytochrome ubiquinol oxidase subunit I | - |
| LQ100_RS11470 (2374731) | 2374731..2374907 | + | 177 | WP_003020221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LQ100_RS11475 (2374954) | 2374954..2375370 | + | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LQ100_RS11480 (2375463) | 2375463..2376872 | + | 1410 | WP_003843728.1 | PLP-dependent aminotransferase family protein | - |
| LQ100_RS11485 (2377201) | 2377201..2378346 | + | 1146 | WP_003020212.1 | ABC transporter substrate-binding protein | - |
| LQ100_RS11490 (2378363) | 2378363..2379379 | + | 1017 | WP_058842662.1 | ABC transporter ATP-binding protein | - |
| LQ100_RS11495 (2379380) | 2379380..2380324 | + | 945 | WP_003843727.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6769.80 Da Isoelectric Point: 11.2510
>T295658 WP_003020221.1 NZ_OW849099:2374731-2374907 [Citrobacter freundii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT295658 WP_123924900.1 NZ_OW849099:2374954-2375370 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|