Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 809225..809879 | Replicon | chromosome |
| Accession | NZ_OW849099 | ||
| Organism | Citrobacter freundii isolate 402 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | LQ100_RS03960 | Protein ID | WP_003026936.1 |
| Coordinates | 809472..809879 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | LQ100_RS03955 | Protein ID | WP_003026938.1 |
| Coordinates | 809225..809491 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ100_RS03930 (804426) | 804426..805859 | - | 1434 | WP_048218552.1 | 6-phospho-beta-glucosidase BglA | - |
| LQ100_RS03935 (805980) | 805980..806708 | - | 729 | WP_230142729.1 | MurR/RpiR family transcriptional regulator | - |
| LQ100_RS03940 (806761) | 806761..807072 | + | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ100_RS03945 (807235) | 807235..807894 | + | 660 | WP_003838267.1 | hemolysin III family protein | - |
| LQ100_RS03950 (807988) | 807988..808968 | - | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
| LQ100_RS03955 (809225) | 809225..809491 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| LQ100_RS03960 (809472) | 809472..809879 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
| LQ100_RS03965 (809924) | 809924..810445 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
| LQ100_RS03970 (810559) | 810559..811455 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
| LQ100_RS03975 (811479) | 811479..812192 | + | 714 | WP_003026923.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ100_RS03980 (812198) | 812198..813931 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T295653 WP_003026936.1 NZ_OW849099:809472-809879 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |