Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 260706..261292 Replicon chromosome
Accession NZ_OW849099
Organism Citrobacter freundii isolate 402

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag LQ100_RS01265 Protein ID WP_032937237.1
Coordinates 260924..261292 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag LQ100_RS01260 Protein ID WP_032937236.1
Coordinates 260706..260927 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ100_RS01235 (256505) 256505..257431 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
LQ100_RS01240 (257428) 257428..258705 + 1278 WP_032950432.1 branched chain amino acid ABC transporter permease LivM -
LQ100_RS01245 (258702) 258702..259469 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LQ100_RS01250 (259487) 259487..260200 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LQ100_RS01255 (260303) 260303..260584 + 282 WP_003023442.1 hypothetical protein -
LQ100_RS01260 (260706) 260706..260927 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQ100_RS01265 (260924) 260924..261292 + 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQ100_RS01270 (261536) 261536..262852 + 1317 WP_230140457.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LQ100_RS01275 (262953) 262953..263840 + 888 WP_032937238.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LQ100_RS01280 (263837) 263837..264682 + 846 WP_003023450.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LQ100_RS01285 (264685) 264685..265755 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 257428..266495 9067


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T295652 WP_032937237.1 NZ_OW849099:260924-261292 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT295652 WP_032937236.1 NZ_OW849099:260706-260927 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References