Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
| Location | 107217..108020 | Replicon | plasmid P1 |
| Accession | NZ_OW849083 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | A0A7W3E3C9 |
| Locus tag | LQ154_RS26030 | Protein ID | WP_022652313.1 |
| Coordinates | 107217..107747 (-) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | W8E6Q5 |
| Locus tag | LQ154_RS26035 | Protein ID | WP_022652312.1 |
| Coordinates | 107751..108020 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS26005 (AI2642V1_REPA000000169) | 103159..103635 | + | 477 | Protein_118 | IS3 family transposase | - |
| LQ154_RS26010 (AI2642V1_REPA000000147) | 103776..103934 | - | 159 | Protein_119 | IS5/IS1182 family transposase | - |
| LQ154_RS26015 (AI2642V1_5077) | 104027..105526 | + | 1500 | WP_071444479.1 | IS21-like element ISPlge2 family transposase | - |
| LQ154_RS26020 (AI2642V1_5078) | 105523..106287 | + | 765 | WP_071444478.1 | IS21-like element helper ATPase IstB | - |
| LQ154_RS26025 (AI2642V1_5079) | 106345..107049 | - | 705 | Protein_122 | IS5 family transposase | - |
| LQ154_RS26030 (AI2642V1_5080) | 107217..107747 | - | 531 | WP_022652313.1 | GNAT family N-acetyltransferase | Toxin |
| LQ154_RS26035 (AI2642V1_5081) | 107751..108020 | - | 270 | WP_022652312.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ154_RS26040 (AI2642V1_5082) | 108876..109865 | + | 990 | WP_022652311.1 | RepB family plasmid replication initiator protein | - |
| LQ154_RS26045 (AI2642V1_5083) | 110191..110931 | - | 741 | WP_230129906.1 | site-specific integrase | - |
| LQ154_RS26050 (AI2642V1_REPA000000125) | 111408..111715 | + | 308 | Protein_127 | IS1-like element transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..197744 | 197744 | |
| - | inside | IScluster/Tn | - | - | 78669..113029 | 34360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20349.26 Da Isoelectric Point: 6.7496
>T295649 WP_022652313.1 NZ_OW849083:c107747-107217 [Citrobacter freundii]
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7W3E3C9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z3XDS5 |