Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 75092..75735 | Replicon | plasmid P1 |
| Accession | NZ_OW849083 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A6C0NGR2 |
| Locus tag | LQ154_RS25845 | Protein ID | WP_008322222.1 |
| Coordinates | 75092..75508 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A6C0NE67 |
| Locus tag | LQ154_RS25850 | Protein ID | WP_008322219.1 |
| Coordinates | 75505..75735 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS25825 (AI2642V1_5043) | 71553..71969 | - | 417 | WP_008322233.1 | type II toxin-antitoxin system VapC family toxin | - |
| LQ154_RS25830 (AI2642V1_5044) | 71966..72196 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| LQ154_RS25835 (AI2642V1_5045) | 72449..73471 | - | 1023 | WP_008322227.1 | helicase UvrD | - |
| LQ154_RS25840 (AI2642V1_5046) | 73456..75018 | - | 1563 | WP_008322224.1 | AAA family ATPase | - |
| LQ154_RS25845 (AI2642V1_5047) | 75092..75508 | - | 417 | WP_008322222.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ154_RS25850 (AI2642V1_5048) | 75505..75735 | - | 231 | WP_008322219.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ154_RS25855 | 75859..75984 | + | 126 | Protein_88 | hypothetical protein | - |
| LQ154_RS25860 (AI2642V1_5049) | 76108..76368 | + | 261 | WP_040219223.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| LQ154_RS25865 (AI2642V1_5050) | 76355..76651 | + | 297 | WP_081364705.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LQ154_RS25870 (AI2642V1_5051) | 76883..77317 | - | 435 | WP_004152085.1 | copper resistance system metallochaperone PcoE | - |
| LQ154_RS25875 (AI2642V1_5052) | 77534..78622 | - | 1089 | Protein_92 | copper resistance membrane spanning protein PcoS | - |
| LQ154_RS25880 (AI2642V1_5053) | 78669..78923 | + | 255 | Protein_93 | IS1-like element transposase | - |
| LQ154_RS25885 (AI2642V1_5054) | 78961..80499 | - | 1539 | WP_004201219.1 | IS66-like element ISKpn24 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..197744 | 197744 | |
| - | inside | IScluster/Tn | - | - | 78669..113029 | 34360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15188.56 Da Isoelectric Point: 7.1361
>T295648 WP_008322222.1 NZ_OW849083:c75508-75092 [Citrobacter freundii]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNQRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNQRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NGR2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE67 |