Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 75092..75735 Replicon plasmid P1
Accession NZ_OW849083
Organism Citrobacter freundii isolate 8

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NGR2
Locus tag LQ154_RS25845 Protein ID WP_008322222.1
Coordinates 75092..75508 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A6C0NE67
Locus tag LQ154_RS25850 Protein ID WP_008322219.1
Coordinates 75505..75735 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ154_RS25825 (AI2642V1_5043) 71553..71969 - 417 WP_008322233.1 type II toxin-antitoxin system VapC family toxin -
LQ154_RS25830 (AI2642V1_5044) 71966..72196 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin -
LQ154_RS25835 (AI2642V1_5045) 72449..73471 - 1023 WP_008322227.1 helicase UvrD -
LQ154_RS25840 (AI2642V1_5046) 73456..75018 - 1563 WP_008322224.1 AAA family ATPase -
LQ154_RS25845 (AI2642V1_5047) 75092..75508 - 417 WP_008322222.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ154_RS25850 (AI2642V1_5048) 75505..75735 - 231 WP_008322219.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ154_RS25855 75859..75984 + 126 Protein_88 hypothetical protein -
LQ154_RS25860 (AI2642V1_5049) 76108..76368 + 261 WP_040219223.1 type II toxin-antitoxin system ParD family antitoxin -
LQ154_RS25865 (AI2642V1_5050) 76355..76651 + 297 WP_081364705.1 type II toxin-antitoxin system RelE/ParE family toxin -
LQ154_RS25870 (AI2642V1_5051) 76883..77317 - 435 WP_004152085.1 copper resistance system metallochaperone PcoE -
LQ154_RS25875 (AI2642V1_5052) 77534..78622 - 1089 Protein_92 copper resistance membrane spanning protein PcoS -
LQ154_RS25880 (AI2642V1_5053) 78669..78923 + 255 Protein_93 IS1-like element transposase -
LQ154_RS25885 (AI2642V1_5054) 78961..80499 - 1539 WP_004201219.1 IS66-like element ISKpn24 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..197744 197744
- inside IScluster/Tn - - 78669..113029 34360


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15188.56 Da        Isoelectric Point: 7.1361

>T295648 WP_008322222.1 NZ_OW849083:c75508-75092 [Citrobacter freundii]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNQRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8736.84 Da        Isoelectric Point: 4.4692

>AT295648 WP_008322219.1 NZ_OW849083:c75735-75505 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVTDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NGR2

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0NE67

References