Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 71553..72196 Replicon plasmid P1
Accession NZ_OW849083
Organism Citrobacter freundii isolate 8

Toxin (Protein)


Gene name vagD Uniprot ID A0A6C0NE46
Locus tag LQ154_RS25825 Protein ID WP_008322233.1
Coordinates 71553..71969 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag LQ154_RS25830 Protein ID WP_001261276.1
Coordinates 71966..72196 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ154_RS25810 (AI2642V1_5040) 67623..68642 + 1020 WP_004113181.1 ribose ABC transporter permease -
LQ154_RS25815 (AI2642V1_5041) 68720..70090 + 1371 WP_008322237.1 hypothetical protein -
LQ154_RS25820 (AI2642V1_5042) 70087..71007 + 921 WP_008322235.1 carbohydrate kinase -
LQ154_RS25825 (AI2642V1_5043) 71553..71969 - 417 WP_008322233.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ154_RS25830 (AI2642V1_5044) 71966..72196 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ154_RS25835 (AI2642V1_5045) 72449..73471 - 1023 WP_008322227.1 helicase UvrD -
LQ154_RS25840 (AI2642V1_5046) 73456..75018 - 1563 WP_008322224.1 AAA family ATPase -
LQ154_RS25845 (AI2642V1_5047) 75092..75508 - 417 WP_008322222.1 type II toxin-antitoxin system VapC family toxin -
LQ154_RS25850 (AI2642V1_5048) 75505..75735 - 231 WP_008322219.1 type II toxin-antitoxin system VapB family antitoxin -
LQ154_RS25855 75859..75984 + 126 Protein_88 hypothetical protein -
LQ154_RS25860 (AI2642V1_5049) 76108..76368 + 261 WP_040219223.1 type II toxin-antitoxin system ParD family antitoxin -
LQ154_RS25865 (AI2642V1_5050) 76355..76651 + 297 WP_081364705.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..197744 197744


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15054.58 Da        Isoelectric Point: 9.2957

>T295647 WP_008322233.1 NZ_OW849083:c71969-71553 [Citrobacter freundii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAASAVLVTNNVREFARVPGLMLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT295647 WP_001261276.1 NZ_OW849083:c72196-71966 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE46

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References