Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4949462..4950078 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
| Locus tag | LQ154_RS24475 | Protein ID | WP_003028682.1 |
| Coordinates | 4949462..4949836 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
| Locus tag | LQ154_RS24480 | Protein ID | WP_043018956.1 |
| Coordinates | 4949836..4950078 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS24460 (4946965) | 4946965..4947867 | + | 903 | WP_106107909.1 | formate dehydrogenase O subunit beta | - |
| LQ154_RS24465 (4947864) | 4947864..4948499 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQ154_RS24470 (4948496) | 4948496..4949425 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| LQ154_RS24475 (4949462) | 4949462..4949836 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ154_RS24480 (4949836) | 4949836..4950078 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
| LQ154_RS24485 (4950284) | 4950284..4951192 | + | 909 | WP_119174684.1 | alpha/beta hydrolase | - |
| LQ154_RS24490 (4951343) | 4951343..4952284 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| LQ154_RS24495 (4952329) | 4952329..4952766 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| LQ154_RS24500 (4952763) | 4952763..4953635 | - | 873 | WP_003840437.1 | virulence factor BrkB family protein | - |
| LQ154_RS24505 (4953629) | 4953629..4954228 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T295646 WP_003028682.1 NZ_OW849082:c4949836-4949462 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MQ96 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B5NTK4 |