Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4644760..4645563 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A6N6JYU3 |
| Locus tag | LQ154_RS23100 | Protein ID | WP_024156451.1 |
| Coordinates | 4645183..4645563 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A5A9BSL8 |
| Locus tag | LQ154_RS23095 | Protein ID | WP_038807908.1 |
| Coordinates | 4644760..4645125 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS23055 (4639826) | 4639826..4640713 | + | 888 | WP_048242072.1 | 50S ribosome-binding GTPase | - |
| LQ154_RS23060 (4640919) | 4640919..4641320 | + | 402 | WP_048242038.1 | hypothetical protein | - |
| LQ154_RS23065 (4641417) | 4641417..4641884 | + | 468 | WP_048242036.1 | hypothetical protein | - |
| LQ154_RS23070 (4642075) | 4642075..4642335 | + | 261 | WP_048242035.1 | DUF905 family protein | - |
| LQ154_RS23075 (4642451) | 4642451..4643269 | + | 819 | WP_048242033.1 | DUF932 domain-containing protein | - |
| LQ154_RS23080 (4643538) | 4643538..4644011 | + | 474 | WP_024156447.1 | antirestriction protein | - |
| LQ154_RS23085 (4644024) | 4644024..4644503 | + | 480 | WP_024156448.1 | DNA repair protein RadC | - |
| LQ154_RS23090 (4644517) | 4644517..4644738 | + | 222 | WP_024156449.1 | DUF987 domain-containing protein | - |
| LQ154_RS23095 (4644760) | 4644760..4645125 | + | 366 | WP_038807908.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ154_RS23100 (4645183) | 4645183..4645563 | + | 381 | WP_024156451.1 | TA system toxin CbtA family protein | Toxin |
| LQ154_RS23105 (4645560) | 4645560..4646051 | + | 492 | WP_024156452.1 | DUF5983 family protein | - |
| LQ154_RS23110 (4646081) | 4646081..4646277 | + | 197 | Protein_4527 | hypothetical protein | - |
| LQ154_RS23115 (4646360) | 4646360..4647207 | + | 848 | Protein_4528 | DUF4942 domain-containing protein | - |
| LQ154_RS23120 (4647997) | 4647997..4649658 | + | 1662 | WP_048234127.1 | fatty acid--CoA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14263.44 Da Isoelectric Point: 10.0919
>T295645 WP_024156451.1 NZ_OW849082:4645183-4645563 [Citrobacter freundii]
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
Download Length: 381 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13344.20 Da Isoelectric Point: 5.8705
>AT295645 WP_038807908.1 NZ_OW849082:4644760-4645125 [Citrobacter freundii]
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6N6JYU3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5A9BSL8 |