Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4475788..4476304 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A133L8K5 |
| Locus tag | LQ154_RS22215 | Protein ID | WP_003844927.1 |
| Coordinates | 4475788..4476072 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0J1MV10 |
| Locus tag | LQ154_RS22220 | Protein ID | WP_003839576.1 |
| Coordinates | 4476062..4476304 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS22200 (4471014) | 4471014..4472666 | + | 1653 | WP_205461297.1 | alpha,alpha-phosphotrehalase | - |
| LQ154_RS22205 (4473075) | 4473075..4475213 | + | 2139 | WP_003844922.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LQ154_RS22210 (4475320) | 4475320..4475784 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LQ154_RS22215 (4475788) | 4475788..4476072 | - | 285 | WP_003844927.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ154_RS22220 (4476062) | 4476062..4476304 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LQ154_RS22225 (4476382) | 4476382..4478295 | - | 1914 | WP_003844930.1 | BglG family transcription antiterminator | - |
| LQ154_RS22230 (4478317) | 4478317..4479057 | - | 741 | WP_048216922.1 | KDGP aldolase family protein | - |
| LQ154_RS22235 (4479054) | 4479054..4480172 | - | 1119 | WP_054527995.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| LQ154_RS22240 (4480156) | 4480156..4481289 | - | 1134 | WP_060855415.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10892.76 Da Isoelectric Point: 10.0482
>T295644 WP_003844927.1 NZ_OW849082:c4476072-4475788 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLLYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLLYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A133L8K5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MV10 |