Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3824335..3824955 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | LQ154_RS19220 | Protein ID | WP_002892050.1 |
| Coordinates | 3824737..3824955 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | LQ154_RS19215 | Protein ID | WP_003021733.1 |
| Coordinates | 3824335..3824709 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS19205 (3819481) | 3819481..3820674 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ154_RS19210 (3820697) | 3820697..3823846 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| LQ154_RS19215 (3824335) | 3824335..3824709 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ154_RS19220 (3824737) | 3824737..3824955 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| LQ154_RS19225 (3825262) | 3825262..3825813 | + | 552 | WP_003835924.1 | maltose O-acetyltransferase | - |
| LQ154_RS19230 (3825930) | 3825930..3826400 | + | 471 | WP_087879033.1 | YlaC family protein | - |
| LQ154_RS19235 (3826479) | 3826479..3826619 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| LQ154_RS19240 (3826621) | 3826621..3826881 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
| LQ154_RS19245 (3827070) | 3827070..3828623 | + | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
| LQ154_RS19250 (3828675) | 3828675..3829028 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| LQ154_RS19255 (3829093) | 3829093..3829722 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295643 WP_002892050.1 NZ_OW849082:3824737-3824955 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT295643 WP_003021733.1 NZ_OW849082:3824335-3824709 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |