Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 3055629..3056219 | Replicon | chromosome |
Accession | NZ_OW849082 | ||
Organism | Citrobacter freundii isolate 8 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A0J1NBD3 |
Locus tag | LQ154_RS15235 | Protein ID | WP_003836692.1 |
Coordinates | 3055629..3055961 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0J1NBD4 |
Locus tag | LQ154_RS15240 | Protein ID | WP_003836694.1 |
Coordinates | 3055962..3056219 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ154_RS15210 (3051382) | 3051382..3052869 | + | 1488 | WP_003846749.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
LQ154_RS15220 (3053185) | 3053185..3054135 | - | 951 | WP_119174146.1 | HTH-type transcriptional regulator Cbl | - |
LQ154_RS15225 (3054237) | 3054237..3055154 | - | 918 | WP_044700649.1 | nitrogen assimilation transcriptional regulator NAC | - |
LQ154_RS15235 (3055629) | 3055629..3055961 | - | 333 | WP_003836692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
LQ154_RS15240 (3055962) | 3055962..3056219 | - | 258 | WP_003836694.1 | hypothetical protein | Antitoxin |
LQ154_RS15245 (3056833) | 3056833..3059829 | + | 2997 | WP_230129733.1 | hypothetical protein | - |
LQ154_RS15250 (3059913) | 3059913..3060944 | + | 1032 | WP_032425611.1 | IS630-like element ISEc33 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3054237..3075159 | 20922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11703.48 Da Isoelectric Point: 8.5572
>T295642 WP_003836692.1 NZ_OW849082:c3055961-3055629 [Citrobacter freundii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD4 |