Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2515980..2516619 | Replicon | chromosome |
Accession | NZ_OW849082 | ||
Organism | Citrobacter freundii isolate 8 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | LQ154_RS12490 | Protein ID | WP_071684398.1 |
Coordinates | 2515980..2516156 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LQ154_RS12495 | Protein ID | WP_123924900.1 |
Coordinates | 2516203..2516619 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ154_RS12470 (2512758) | 2512758..2512988 | - | 231 | WP_003020233.1 | DUF2554 family protein | - |
LQ154_RS12475 (2513178) | 2513178..2513303 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
LQ154_RS12480 (2513303) | 2513303..2514313 | - | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
LQ154_RS12485 (2514313) | 2514313..2515716 | - | 1404 | WP_003843730.1 | cytochrome ubiquinol oxidase subunit I | - |
LQ154_RS12490 (2515980) | 2515980..2516156 | + | 177 | WP_071684398.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LQ154_RS12495 (2516203) | 2516203..2516619 | + | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LQ154_RS12500 (2516712) | 2516712..2518121 | + | 1410 | WP_003836140.1 | PLP-dependent aminotransferase family protein | - |
LQ154_RS12505 (2518449) | 2518449..2519594 | + | 1146 | WP_003020212.1 | ABC transporter substrate-binding protein | - |
LQ154_RS12510 (2519611) | 2519611..2520627 | + | 1017 | WP_119174242.1 | ABC transporter ATP-binding protein | - |
LQ154_RS12515 (2520628) | 2520628..2521572 | + | 945 | WP_003843727.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6768.86 Da Isoelectric Point: 11.6208
>T295641 WP_071684398.1 NZ_OW849082:2515980-2516156 [Citrobacter freundii]
VKQSKFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSKFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT295641 WP_123924900.1 NZ_OW849082:2516203-2516619 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|